Class c: Alpha and beta proteins (a/b) [51349] (113 folds) |
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) |
Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (16 families) |
Family c.37.1.8: G proteins [52592] (23 proteins) |
Protein Elongation factor Tu (EF-Tu), N-terminal (G) domain [52626] (4 species) |
Species Cow (Bos taurus), mitochondrial [TaxId:9913] [52630] (1 PDB entry) |
Domain d1d2eb3: 1d2e B:55-250 [32137] Other proteins in same PDB: d1d2ea1, d1d2ea2, d1d2eb1, d1d2eb2, d1d2ec1, d1d2ec2, d1d2ed1, d1d2ed2 |
PDB Entry: 1d2e (more details), 1.94 Å
SCOP Domain Sequences for d1d2eb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d2eb3 c.37.1.8 (B:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial} kphvnvgtighvdhgkttltaaitkilaegggakfkkyeeidnapeerargitinaahve ystaarhyahtdcpghadyvknmitgtapldgcilvvaandgpmpqtrehlllarqigve hvvvyvnkadavqdsemvelveleirelltefgykgeetpiivgsalcaleqrdpelglk svqklldavdtyipvp
Timeline for d1d2eb3: