Lineage for d1d2eb3 (1d2e B:55-250)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 121667Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 121668Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (16 families) (S)
  5. 121912Family c.37.1.8: G proteins [52592] (23 proteins)
  6. 122012Protein Elongation factor Tu (EF-Tu), N-terminal (G) domain [52626] (4 species)
  7. 122013Species Cow (Bos taurus), mitochondrial [TaxId:9913] [52630] (1 PDB entry)
  8. 122015Domain d1d2eb3: 1d2e B:55-250 [32137]
    Other proteins in same PDB: d1d2ea1, d1d2ea2, d1d2eb1, d1d2eb2, d1d2ec1, d1d2ec2, d1d2ed1, d1d2ed2

Details for d1d2eb3

PDB Entry: 1d2e (more details), 1.94 Å

PDB Description: crystal structure of mitochondrial ef-tu in complex with gdp

SCOP Domain Sequences for d1d2eb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d2eb3 c.37.1.8 (B:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial}
kphvnvgtighvdhgkttltaaitkilaegggakfkkyeeidnapeerargitinaahve
ystaarhyahtdcpghadyvknmitgtapldgcilvvaandgpmpqtrehlllarqigve
hvvvyvnkadavqdsemvelveleirelltefgykgeetpiivgsalcaleqrdpelglk
svqklldavdtyipvp

SCOP Domain Coordinates for d1d2eb3:

Click to download the PDB-style file with coordinates for d1d2eb3.
(The format of our PDB-style files is described here.)

Timeline for d1d2eb3: