Lineage for d1d2ea3 (1d2e A:55-250)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 695085Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 695086Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 695634Family c.37.1.8: G proteins [52592] (78 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 695886Protein Elongation factor Tu (EF-Tu), N-terminal (G) domain [52626] (4 species)
  7. 695887Species Cow (Bos taurus), mitochondrial [TaxId:9913] [52630] (2 PDB entries)
  8. 695888Domain d1d2ea3: 1d2e A:55-250 [32136]
    Other proteins in same PDB: d1d2ea1, d1d2ea2, d1d2eb1, d1d2eb2, d1d2ec1, d1d2ec2, d1d2ed1, d1d2ed2

Details for d1d2ea3

PDB Entry: 1d2e (more details), 1.94 Å

PDB Description: crystal structure of mitochondrial ef-tu in complex with gdp
PDB Compounds: (A:) elongation factor tu (ef-tu)

SCOP Domain Sequences for d1d2ea3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]}
kphvnvgtighvdhgkttltaaitkilaegggakfkkyeeidnapeerargitinaahve
ystaarhyahtdcpghadyvknmitgtapldgcilvvaandgpmpqtrehlllarqigve
hvvvyvnkadavqdsemvelveleirelltefgykgeetpiivgsalcaleqrdpelglk
svqklldavdtyipvp

SCOP Domain Coordinates for d1d2ea3:

Click to download the PDB-style file with coordinates for d1d2ea3.
(The format of our PDB-style files is described here.)

Timeline for d1d2ea3: