SCOPe 2.07: Domain d5iyze_: 5iyz E:

Lineage for d5iyze_ (5iyz E:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
   not a true fold

4. Superfamily a.137.10: Stathmin [101494] (1 family)
   single long helix crosslinking four tubulin subunits
   automatically mapped to Pfam PF00836

5. Family a.137.10.1: Stathmin [101495] (2 proteins)

6. Protein Stathmin 4 [101496] (2 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (97 PDB entries)

8. Domain d5iyze_: 5iyz E: [321354]
   Other proteins in same PDB: d5iyza1, d5iyza2, d5iyzb1, d5iyzb2, d5iyzc1, d5iyzc2, d5iyzd1, d5iyzd2, d5iyzf1, d5iyzf2, d5iyzf3
   automated match to d4i55e_
   complexed with 4q5, acp, ca, gdp, gtp, mes, mg

Details for d5iyze_

PDB Entry: 5iyz, 1.8 Å

PDB Description: tubulin-mmae complex

PDB Compounds: (E:) Stathmin-4

SCOPe Domain Sequences for d5iyze_:

Sequence, based on SEQRES records:

>d5iyze_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe
aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe
kdkhaeevrknkelkeea

Sequence, based on observed residues (ATOM records):

>d5iyze_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsdpsleeiqkkleaaeerrkyqeaellkhlaekreher
eviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelk
eea

Timeline for d5iyze_:

• d5iyze_ first appeared in SCOPe 2.06