Lineage for d5hs7b1 (5hs7 B:5-101)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304501Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2305606Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2307165Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2307166Protein automated matches [190154] (76 species)
    not a true protein
  7. 2307198Species Bacillus subtilis [TaxId:224308] [321300] (3 PDB entries)
  8. 2307200Domain d5hs7b1: 5hs7 B:5-101 [321346]
    Other proteins in same PDB: d5hs7a2, d5hs7b2
    automated match to d4hqmb_
    complexed with gol

Details for d5hs7b1

PDB Entry: 5hs7 (more details), 1.7 Å

PDB Description: reduced form of the transcriptional regulator yodb from b. subtilis
PDB Compounds: (B:) HTH-type transcriptional regulator YodB

SCOPe Domain Sequences for d5hs7b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hs7b1 a.4.5.0 (B:5-101) automated matches {Bacillus subtilis [TaxId: 224308]}
mcpkmesafsllgkrwngliihvlmdgpkrfkeitetipmisqkmlaerlkeleqneive
rqvlpetpvkviytltekgtalqavfqemqawadqfc

SCOPe Domain Coordinates for d5hs7b1:

Click to download the PDB-style file with coordinates for d5hs7b1.
(The format of our PDB-style files is described here.)

Timeline for d5hs7b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5hs7b2