SCOPe 2.06: Domain d5dmxd2: 5dmx D:99-304

Lineage for d5dmxd2 (5dmx D:99-304)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.142: ATP-grasp [56058] (2 superfamilies)
   Consists of two subdomains with different alpha+beta folds
   shares functional and structural similarities with the PIPK and protein kinase superfamilies

4. Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families)

5. Family d.142.1.0: automated matches [227184] (1 protein)
   not a true family

6. Protein automated matches [226904] (32 species)
   not a true protein

7. Species Acinetobacter baumannii [TaxId:405416] [321246] (2 PDB entries)

8. Domain d5dmxd2: 5dmx D:99-304 [321341]
   Other proteins in same PDB: d5dmxa1, d5dmxb1, d5dmxc1, d5dmxd1, d5dmxe1, d5dmxf1
   automated match to d4egjc2

Details for d5dmxd2

PDB Entry: 5dmx, 2.81 Å

PDB Description: crystal structure of d-alanine-d-alanine ligase from acinetobacter baumannii, space group p212121

PDB Compounds: (D:) d-alanine--d-alanine ligase

SCOPe Domain Sequences for d5dmxd2:

Sequence, based on SEQRES records:

>d5dmxd2 d.142.1.0 (D:99-304) automated matches {Acinetobacter baumannii [TaxId: 405416]}
dkvktkqiwqgsdlptapyriitketdldsviaelglpviikpvhegssvgmskvekaed
faaaiekatqhdavvmaekwitgreftisflngqplpvirlqppadvafydyeakyqrnd
veygipcglseteekklqalclrafqavgaegwgridamqdeqgnfwllevntvpgmtsh
slvpkaakavgysfdelcvaileqtl

Sequence, based on observed residues (ATOM records):

>d5dmxd2 d.142.1.0 (D:99-304) automated matches {Acinetobacter baumannii [TaxId: 405416]}
dkvktkqiwqgsdlptapyriitketdldsviaelglpviikpvhevgmskvekaedfaa
aiekatqhdavvmaekwitgreftisflngqplpvirlgipcglseteekklqalclraf
qavgaegwgridamqdeqgnfwllevntvpgmtshslvpkaakavgysfdelcvaileqt
l

Timeline for d5dmxd2:

• d5dmxd2 is new in SCOPe 2.06-stable
  
• d5dmxd2 appears in SCOPe 2.07
  
• d5dmxd2 appears in the current release, SCOPe 2.08