SCOP 1.71: Domain d1aipe3: 1aip E:9-212

Lineage for d1aipe3 (1aip E:9-212)

Root: SCOP 1.71
Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families)
division into families based on beta-sheet topologies
Family c.37.1.8: G proteins [52592] (45 proteins)
core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
Protein Elongation factor Tu (EF-Tu), N-terminal (G) domain [52626] (4 species)
Species Thermus thermophilus [TaxId:274] [52629] (3 PDB entries)

Domain d1aipe3: 1aip E:9-212 [32134]
Other proteins in same PDB: d1aipa1, d1aipa2, d1aipb1, d1aipb2, d1aipc1, d1aipc2, d1aipd1, d1aipd2, d1aipe1, d1aipe2, d1aipf1, d1aipf2, d1aipg1, d1aipg2, d1aiph1, d1aiph2

Details for d1aipe3

PDB Entry: 1aip (more details), 3 Å

PDB Description: ef-tu ef-ts complex from thermus thermophilus

SCOP Domain Sequences for d1aipe3:

Sequence, based on SEQRES records: (download)

>d1aipe3 c.37.1.8 (E:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus}
kphvnvgtighvdhgkttltaaltyvtaaenpnvevkdygdidkapeerargitintahv
eyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehillarqvgv
pyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallaleqmhrnpkt
rrgenewvdkiwelldaideyipt

Sequence, based on observed residues (ATOM records): (download)

>d1aipe3 c.37.1.8 (E:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus}
kphvnvgtighvdhgkttltaaltyvtaaenpahveyetakrhyshvdcpghadyiknmi
tgaaqmdgailvvsaadgpmpqtrehillarqvgvpyivvfmnkvdmvddpelldlveme
vrdllnqyefpgdevpvirgsallaleqmhrnpktrrgenewvdkiwelldaideyipt

SCOP Domain Coordinates for d1aipe3:

Click to download the PDB-style file with coordinates for d1aipe3.
(The format of our PDB-style files is described here.)

Timeline for d1aipe3: