Lineage for d1aipe3 (1aip E:9-212)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22942Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 22943Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) (S)
  5. 23121Family c.37.1.8: G proteins [52592] (20 proteins)
  6. 23203Protein Elongation factor Tu (EF-Tu), N-terminal (G) domain [52626] (4 species)
  7. 23229Species Thermus thermophilus [TaxId:274] [52629] (2 PDB entries)
  8. 23233Domain d1aipe3: 1aip E:9-212 [32134]
    Other proteins in same PDB: d1aipa1, d1aipa2, d1aipb1, d1aipb2, d1aipc_, d1aipd_, d1aipe1, d1aipe2, d1aipf1, d1aipf2, d1aipg_, d1aiph_

Details for d1aipe3

PDB Entry: 1aip (more details), 3 Å

PDB Description: ef-tu ef-ts complex from thermus thermophilus

SCOP Domain Sequences for d1aipe3:

Sequence, based on SEQRES records: (download)

>d1aipe3 c.37.1.8 (E:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus}
kphvnvgtighvdhgkttltaaltyvtaaenpnvevkdygdidkapeerargitintahv
eyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehillarqvgv
pyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallaleqmhrnpkt
rrgenewvdkiwelldaideyipt

Sequence, based on observed residues (ATOM records): (download)

>d1aipe3 c.37.1.8 (E:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus}
kphvnvgtighvdhgkttltaaltyvtaaenpahveyetakrhyshvdcpghadyiknmi
tgaaqmdgailvvsaadgpmpqtrehillarqvgvpyivvfmnkvdmvddpelldlveme
vrdllnqyefpgdevpvirgsallaleqmhrnpktrrgenewvdkiwelldaideyipt

SCOP Domain Coordinates for d1aipe3:

Click to download the PDB-style file with coordinates for d1aipe3.
(The format of our PDB-style files is described here.)

Timeline for d1aipe3: