![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.8: G proteins [52592] (80 protein domains) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
![]() | Protein RhoA [52612] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [52613] (33 PDB entries) Uniprot P61586 2-181 |
![]() | Domain d5ircd_: 5irc D: [321339] Other proteins in same PDB: d5irca1, d5irca2, d5ircb_ automated match to d1cxza_ complexed with cl, gdp, mg, mgf |
PDB Entry: 5irc (more details), 1.72 Å
SCOPe Domain Sequences for d5ircd_:
Sequence, based on SEQRES records: (download)
>d5ircd_ c.37.1.8 (D:) RhoA {Human (Homo sapiens) [TaxId: 9606]} irkklvivgdgacgktcllivnskdqfpevyvptvfenyvadievdgkqvelalwdtagq edydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkdlrn dehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraalqa
>d5ircd_ c.37.1.8 (D:) RhoA {Human (Homo sapiens) [TaxId: 9606]} irkklvivgdgacgktcllivnvyvptvfenyvadievdgkqvelalwdtagqedydrlr plsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkdlrndehtrre lakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraalqa
Timeline for d5ircd_:
![]() Domains from other chains: (mouse over for more information) d5irca1, d5irca2, d5ircb_, d5ircf_ |