Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214 |
Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) |
Family c.79.1.0: automated matches [191338] (1 protein) not a true family |
Protein automated matches [190215] (38 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:83332] [188609] (9 PDB entries) |
Domain d5i6dd_: 5i6d D: [321335] Other proteins in same PDB: d5i6dc2 automated match to d3dwia_ complexed with au6, gol, plp |
PDB Entry: 5i6d (more details), 1.64 Å
SCOPe Domain Sequences for d5i6dd_:
Sequence, based on SEQRES records: (download)
>d5i6dd_ c.79.1.0 (D:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} rydsllqalgntplvglqrlsprwddgrdgphvrlwakledrnptgsikdrpavrmieqa eadgllrpgatileptsgntgislamaarlkgyrlicvmpentsverrqllelygaqiif saaeggsntavatakelaatnpswvmlyqygnpantdshycgtgpelladlpeithfvag lgttgtlmgtgrflrehvanvkivaaeprygegvyalrnmdegfvpelydpeiltarysv gavdavrrtrelvhtegifagistgavlhaalgvgagalaageradialvvadagwkyls tgayagslddaetalegqlwa
>d5i6dd_ c.79.1.0 (D:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} rydsllqalgntplvglqrlsprwddgrdgphvrlwakledrnptgsikdrpavrmieqa eadgllrpgatileptsgntgislamaarlkgyrlicvmpentsverrqllelygaqiif saasntavatakelaatnpswvmlyqygnpantdshycgtgpelladlpeithfvaglgt tgtlmgtgrflrehvanvkivaaeprygegvyalrnmdegfvpelydpeiltarysvgav davrrtrelvhtegifagistgavlhaalgvgagalaageradialvvadagwkylstga yagslddaetalegqlwa
Timeline for d5i6dd_:
View in 3D Domains from other chains: (mouse over for more information) d5i6da_, d5i6db_, d5i6dc1, d5i6dc2 |