Lineage for d5iyzd1 (5iyz D:1-245)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2445156Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2445157Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2445158Family c.32.1.1: Tubulin, GTPase domain [52491] (4 protein domains)
  6. 2445283Protein automated matches [226837] (7 species)
    not a true protein
  7. 2445289Species Cow (Bos taurus) [TaxId:9913] [226564] (50 PDB entries)
  8. 2445301Domain d5iyzd1: 5iyz D:1-245 [321331]
    Other proteins in same PDB: d5iyza2, d5iyzb2, d5iyzc2, d5iyzd2, d5iyze_, d5iyzf1, d5iyzf2, d5iyzf3
    automated match to d4drxb1
    complexed with 4q5, acp, ca, gdp, gtp, mes, mg

Details for d5iyzd1

PDB Entry: 5iyz (more details), 1.8 Å

PDB Description: tubulin-mmae complex
PDB Compounds: (D:) Tubulin beta-2B chain

SCOPe Domain Sequences for d5iyzd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5iyzd1 c.32.1.1 (D:1-245) automated matches {Cow (Bos taurus) [TaxId: 9913]}
mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyv
prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvv
epynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttcl
rfp

SCOPe Domain Coordinates for d5iyzd1:

Click to download the PDB-style file with coordinates for d5iyzd1.
(The format of our PDB-style files is described here.)

Timeline for d5iyzd1: