Lineage for d1aipa3 (1aip A:9-212)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 829350Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 829351Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 829945Family c.37.1.8: G proteins [52592] (78 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 830208Protein Elongation factor Tu (EF-Tu), N-terminal (G) domain [52626] (4 species)
  7. 830239Species Thermus thermophilus [TaxId:274] [52629] (7 PDB entries)
  8. 830245Domain d1aipa3: 1aip A:9-212 [32132]
    Other proteins in same PDB: d1aipa1, d1aipa2, d1aipb1, d1aipb2, d1aipc1, d1aipc2, d1aipd1, d1aipd2, d1aipe1, d1aipe2, d1aipf1, d1aipf2, d1aipg1, d1aipg2, d1aiph1, d1aiph2

Details for d1aipa3

PDB Entry: 1aip (more details), 3 Å

PDB Description: ef-tu ef-ts complex from thermus thermophilus
PDB Compounds: (A:) elongation factor tu

SCOP Domain Sequences for d1aipa3:

Sequence, based on SEQRES records: (download)

>d1aipa3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]}
kphvnvgtighvdhgkttltaaltyvtaaenpnvevkdygdidkapeerargitintahv
eyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehillarqvgv
pyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallaleqmhrnpkt
rrgenewvdkiwelldaideyipt

Sequence, based on observed residues (ATOM records): (download)

>d1aipa3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]}
kphvnvgtighvdhgkttltaaltyvtaaenptahveyetakrhyshvdcpghadyiknm
itgaaqmdgailvvsaadgpmpqtrehillarqvgvpyivvfmnkvdmvddpelldlvem
evrdllnqyefpgdevpvirgsallaleqmhrnpktrrgenewvdkiwelldaideyipt

SCOP Domain Coordinates for d1aipa3:

Click to download the PDB-style file with coordinates for d1aipa3.
(The format of our PDB-style files is described here.)

Timeline for d1aipa3: