![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.8: G proteins [52592] (78 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
![]() | Protein Elongation factor Tu (EF-Tu), N-terminal (G) domain [52626] (4 species) |
![]() | Species Thermus thermophilus [TaxId:274] [52629] (7 PDB entries) |
![]() | Domain d1aipa3: 1aip A:9-212 [32132] Other proteins in same PDB: d1aipa1, d1aipa2, d1aipb1, d1aipb2, d1aipc1, d1aipc2, d1aipd1, d1aipd2, d1aipe1, d1aipe2, d1aipf1, d1aipf2, d1aipg1, d1aipg2, d1aiph1, d1aiph2 |
PDB Entry: 1aip (more details), 3 Å
SCOP Domain Sequences for d1aipa3:
Sequence, based on SEQRES records: (download)
>d1aipa3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} kphvnvgtighvdhgkttltaaltyvtaaenpnvevkdygdidkapeerargitintahv eyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehillarqvgv pyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallaleqmhrnpkt rrgenewvdkiwelldaideyipt
>d1aipa3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} kphvnvgtighvdhgkttltaaltyvtaaenptahveyetakrhyshvdcpghadyiknm itgaaqmdgailvvsaadgpmpqtrehillarqvgvpyivvfmnkvdmvddpelldlvem evrdllnqyefpgdevpvirgsallaleqmhrnpktrrgenewvdkiwelldaideyipt
Timeline for d1aipa3: