Lineage for d5in4c1 (5in4 C:23-372)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841375Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

    has additional subdomain(s) that are not in the common domain
  6. 2842441Protein GDP-mannose 4,6-dehydratase [51759] (4 species)
  7. 2842444Species Human (Homo sapiens) [TaxId:9606] [102135] (7 PDB entries)
  8. 2842455Domain d5in4c1: 5in4 C:23-372 [321313]
    Other proteins in same PDB: d5in4a2, d5in4b2, d5in4c2, d5in4d2
    automated match to d1t2aa_
    complexed with 6ck, gdp, nap

    has additional subdomain(s) that are not in the common domain

Details for d5in4c1

PDB Entry: 5in4 (more details), 1.6 Å

PDB Description: crystal structure of gdp-mannose 4,6 dehydratase bound to a gdp-fucose based inhibitor
PDB Compounds: (C:) GDP-mannose 4,6 dehydratase

SCOPe Domain Sequences for d5in4c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5in4c1 c.2.1.2 (C:23-372) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]}
rnvalitgitgqdgsylaefllekgyevhgivrrsssfntgriehlyknpqahiegnmkl
hygdltdstclvkiinevkpteiynlgaqshvkisfdlaeytadvdgvgtlrlldavktc
glinsvkfyqastselygkvqeipqkettpfyprspygaaklyaywivvnfreaynlfav
ngilfnhesprrganfvtrkisrsvakiylgqlecfslgnldakrdwghakdyveamwlm
lqndepedfviatgevhsvrefveksflhigktivwegknenevgrcketgkvhvtvdlk
yyrptevdflqgdctkakqklnwkprvafdelvremvhadvelmrtnpna

SCOPe Domain Coordinates for d5in4c1:

Click to download the PDB-style file with coordinates for d5in4c1.
(The format of our PDB-style files is described here.)

Timeline for d5in4c1: