Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 has additional subdomain(s) that are not in the common domain |
Protein GDP-mannose 4,6-dehydratase [51759] (4 species) |
Species Human (Homo sapiens) [TaxId:9606] [102135] (7 PDB entries) |
Domain d5in4c1: 5in4 C:23-372 [321313] Other proteins in same PDB: d5in4a2, d5in4b2, d5in4c2, d5in4d2 automated match to d1t2aa_ complexed with 6ck, gdp, nap has additional subdomain(s) that are not in the common domain |
PDB Entry: 5in4 (more details), 1.6 Å
SCOPe Domain Sequences for d5in4c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5in4c1 c.2.1.2 (C:23-372) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} rnvalitgitgqdgsylaefllekgyevhgivrrsssfntgriehlyknpqahiegnmkl hygdltdstclvkiinevkpteiynlgaqshvkisfdlaeytadvdgvgtlrlldavktc glinsvkfyqastselygkvqeipqkettpfyprspygaaklyaywivvnfreaynlfav ngilfnhesprrganfvtrkisrsvakiylgqlecfslgnldakrdwghakdyveamwlm lqndepedfviatgevhsvrefveksflhigktivwegknenevgrcketgkvhvtvdlk yyrptevdflqgdctkakqklnwkprvafdelvremvhadvelmrtnpna
Timeline for d5in4c1: