![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
![]() | Protein Elongation factor Tu (EF-Tu), N-terminal (G) domain [52626] (4 species) |
![]() | Species Thermus thermophilus [TaxId:274] [52629] (7 PDB entries) |
![]() | Domain d1exma3: 1exm A:3-212 [32131] Other proteins in same PDB: d1exma1, d1exma2 protein/RNA complex; complexed with gnp, mg |
PDB Entry: 1exm (more details), 1.7 Å
SCOPe Domain Sequences for d1exma3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1exma3 c.37.1.8 (A:3-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} gefirtkphvnvgtighvdhgkttltaaltfvtaaenpnvevkdygdidkapeerargit intahveyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehill arqvgvpyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallaleqm hrnpktrrgenewvdkiwelldaideyipt
Timeline for d1exma3: