Lineage for d1exma3 (1exm A:3-212)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 69448Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 69449Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (15 families) (S)
  5. 69650Family c.37.1.8: G proteins [52592] (20 proteins)
  6. 69737Protein Elongation factor Tu (EF-Tu), N-terminal (G) domain [52626] (4 species)
  7. 69763Species Thermus thermophilus [TaxId:274] [52629] (3 PDB entries)
  8. 69764Domain d1exma3: 1exm A:3-212 [32131]
    Other proteins in same PDB: d1exma1, d1exma2

Details for d1exma3

PDB Entry: 1exm (more details), 1.7 Å

PDB Description: crystal structure of thermus thermophilus elongation factor tu (ef-tu) in complex with the gtp analogue gppnhp.

SCOP Domain Sequences for d1exma3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1exma3 c.37.1.8 (A:3-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus}
gefirtkphvnvgtighvdhgkttltaaltfvtaaenpnvevkdygdidkapeerargit
intahveyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehill
arqvgvpyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallaleqm
hrnpktrrgenewvdkiwelldaideyipt

SCOP Domain Coordinates for d1exma3:

Click to download the PDB-style file with coordinates for d1exma3.
(The format of our PDB-style files is described here.)

Timeline for d1exma3: