SCOPe 2.07: Domain d5hs7a1: 5hs7 A:5-105

Lineage for d5hs7a1 (5hs7 A:5-105)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (87 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:224308] [321300] (5 PDB entries)

8. Domain d5hs7a1: 5hs7 A:5-105 [321307]
   Other proteins in same PDB: d5hs7a2, d5hs7b2
   automated match to d4hqmb_
   complexed with gol

Details for d5hs7a1

PDB Entry: 5hs7, 1.7 Å

PDB Description: reduced form of the transcriptional regulator yodb from b. subtilis

PDB Compounds: (A:) HTH-type transcriptional regulator YodB

SCOPe Domain Sequences for d5hs7a1:

Sequence; same for both SEQRES and ATOM records:

>d5hs7a1 a.4.5.0 (A:5-105) automated matches {Bacillus subtilis [TaxId: 224308]}
mcpkmesafsllgkrwngliihvlmdgpkrfkeitetipmisqkmlaerlkeleqneive
rqvlpetpvkviytltekgtalqavfqemqawadqfcepgd

Timeline for d5hs7a1:

• d5hs7a1 first appeared in SCOPe 2.06
  
• d5hs7a1 appears in the current release, SCOPe 2.08