![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
![]() | Protein automated matches [190154] (92 species) not a true protein |
![]() | Species Bacillus subtilis [TaxId:224308] [321300] (5 PDB entries) |
![]() | Domain d5hs7a1: 5hs7 A:5-105 [321307] Other proteins in same PDB: d5hs7a2, d5hs7b2 automated match to d4hqmb_ complexed with gol |
PDB Entry: 5hs7 (more details), 1.7 Å
SCOPe Domain Sequences for d5hs7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hs7a1 a.4.5.0 (A:5-105) automated matches {Bacillus subtilis [TaxId: 224308]} mcpkmesafsllgkrwngliihvlmdgpkrfkeitetipmisqkmlaerlkeleqneive rqvlpetpvkviytltekgtalqavfqemqawadqfcepgd
Timeline for d5hs7a1: