SCOPe 2.08: Domain d5i7rb_: 5i7r B:

Lineage for d5i7rb_ (5i7r B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214

4. Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families)

5. Family c.79.1.0: automated matches [191338] (1 protein)
   not a true family

6. Protein automated matches [190215] (38 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [188609] (9 PDB entries)

8. Domain d5i7rb_: 5i7r B: [321306]
   automated match to d3dwia_
   complexed with 68w, act, plp

Details for d5i7rb_

PDB Entry: 5i7r, 1.73 Å

PDB Description: mycobacterium tuberculosis cysm in complex with the urea-scaffold inhibitor 2 [3-(3-([1,1'-biphenyl]-3-yl)ureido)benzoic acid]

PDB Compounds: (B:) O-phosphoserine sulfhydrylase

SCOPe Domain Sequences for d5i7rb_:

Sequence; same for both SEQRES and ATOM records:

>d5i7rb_ c.79.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
arydsllqalgntplvglqrlsprwddgrdgphvrlwakledrnptgsikdrpavrmieq
aeadgllrpgatileptsgntgislamaarlkgyrlicvmpentsverrqllelygaqii
fsaaeggsntavatakelaatnpswvmlyqygnpantdshycgtgpelladlpeithfva
glgttgtlmgtgrflrehvanvkivaaeprygegvyalrnmdegfvpelydpeiltarys
vgavdavrrtrelvhtegifagistgavlhaalgvgagalaageradialvvadagwkyl
stgayagslddaetal

Timeline for d5i7rb_:

• d5i7rb_ first appeared in SCOPe 2.06
  
• d5i7rb_ appears in SCOPe 2.07