Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (78 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein Elongation factor Tu (EF-Tu), N-terminal (G) domain [52626] (4 species) |
Species Thermus aquaticus [TaxId:271] [52628] (4 PDB entries) |
Domain d1tuic3: 1tui C:9-212 [32130] Other proteins in same PDB: d1tuia1, d1tuia2, d1tuib1, d1tuib2, d1tuic1, d1tuic2 complexed with gdp, mg |
PDB Entry: 1tui (more details), 2.7 Å
SCOP Domain Sequences for d1tuic3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tuic3 c.37.1.8 (C:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus aquaticus [TaxId: 271]} kphvnvgtighvdhgkttltaaltyvaaaenpnvevkdygdidkapeerargitintahv eyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehillarqvgv pyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallaleemhknpkt krgenewvdkiwelldaideyipt
Timeline for d1tuic3: