![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) ![]() |
![]() | Family d.58.7.0: automated matches [191529] (1 protein) not a true family |
![]() | Protein automated matches [190896] (11 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [279753] (7 PDB entries) |
![]() | Domain d5d78a1: 5d78 A:313-387 [321293] Other proteins in same PDB: d5d78a2 automated match to d2sxla_ complexed with bme, so4 |
PDB Entry: 5d78 (more details), 1.25 Å
SCOPe Domain Sequences for d5d78a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5d78a1 d.58.7.0 (A:313-387) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} ktilvknlpsdttqeevldyfstigpiksvfisekqantphkafvtykneeeskkaqkcl nktifknhtiwvgpg
Timeline for d5d78a1: