SCOPe 2.08: Domain d5d78a1: 5d78 A:313-387

Lineage for d5d78a1 (5d78 A:313-387)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families)

5. Family d.58.7.0: automated matches [191529] (1 protein)
   not a true family

6. Protein automated matches [190896] (11 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [279753] (7 PDB entries)

8. Domain d5d78a1: 5d78 A:313-387 [321293]
   Other proteins in same PDB: d5d78a2
   automated match to d2sxla_
   complexed with bme, so4

Details for d5d78a1

PDB Entry: 5d78, 1.25 Å

PDB Description: structure of rrm3 domain of mip6 at 1.25 a resolution

PDB Compounds: (A:) RNA-binding protein MIP6

SCOPe Domain Sequences for d5d78a1:

Sequence; same for both SEQRES and ATOM records:

>d5d78a1 d.58.7.0 (A:313-387) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ktilvknlpsdttqeevldyfstigpiksvfisekqantphkafvtykneeeskkaqkcl
nktifknhtiwvgpg

Timeline for d5d78a1:

• d5d78a1 first appeared in SCOPe 2.06
  
• d5d78a1 appears in SCOPe 2.07