SCOPe 2.08: Domain d5fqca_: 5fqc A:

Lineage for d5fqca_ (5fqc A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families)

5. Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)

6. Protein automated matches [190079] (12 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [189349] (76 PDB entries)

8. Domain d5fqca_: 5fqc A: [321289]
   automated match to d5a87b_
   complexed with dms, fmt, ok3, zn

Details for d5fqca_

PDB Entry: 5fqc, 1.45 Å

PDB Description: crystal structure of the metallo-beta-lactamase vim-2 with 2c

PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d5fqca_:

Sequence; same for both SEQRES and ATOM records:

>d5fqca_ d.157.1.1 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
eyptvseipvgevrlyqiadgvwshiatqsfdgavypsnglivrdgdelllidtawgakn
taallaeiekqiglpvtravsthfhddrvggvdvlraagvatyaspstrrlaevegneip
thsleglsssgdavrfgpvelfypgaahstdnlvvyvpsasvlyggcaiyelsrtsagnv
adadlaewptsieriqqhypeaqfvipghglpggldllkhttnvvkahtnrs

Timeline for d5fqca_:

• d5fqca_ first appeared in SCOPe 2.06
  
• d5fqca_ appears in SCOPe 2.07