Lineage for d5eyka_ (5eyk A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2218047Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2218048Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2218179Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2220941Protein automated matches [190091] (17 species)
    not a true protein
  7. 2220942Species African clawed frog (Xenopus laevis) [TaxId:8355] [187456] (11 PDB entries)
  8. 2220960Domain d5eyka_: 5eyk A: [321280]
    automated match to d2bfyb_
    complexed with 5u5

Details for d5eyka_

PDB Entry: 5eyk (more details), 1.93 Å

PDB Description: crystal structure of aurora b in complex with bi 847325
PDB Compounds: (A:) aurora kinase b-a

SCOPe Domain Sequences for d5eyka_:

Sequence, based on SEQRES records: (download)

>d5eyka_ d.144.1.7 (A:) automated matches {African clawed frog (Xenopus laevis) [TaxId: 8355]}
ftiddfdivrplgkgkfgnvylarekqnkfimalkvlfksqlekegvehqlrreieiqsh
lrhpnilrmynyfhdrkriylmlefaprgelykelqkhgrfdeqrsatfmeeladalhyc
herkvihrdikpenllmgykgelkiadfgwsvhapslrrrtmcgtldylppemiegkthd
ekvdlwcagvlcyeflvgmppfdspshtethrrivnvdlkfppflsdgskdliskllryh
ppqrlplkgvmehpwvkansrrvlppvy

Sequence, based on observed residues (ATOM records): (download)

>d5eyka_ d.144.1.7 (A:) automated matches {African clawed frog (Xenopus laevis) [TaxId: 8355]}
ftiddfdivrplgkgkfgnvylarekqnkfimalkvlfksqlekegvehqlrreieiqsh
lrhpnilrmynyfhdrkriylmlefaprgelykelqkhgrfdeqrsatfmeeladalhyc
herkvihrdikpenllmgykgelkiadfgwsvharrtmcgtldylppemiegkthdekvd
lwcagvlcyeflvgmppfdspshtethrrivnvdlkfppflsdgskdliskllryhppqr
lplkgvmehpwvkansrrvlppvy

SCOPe Domain Coordinates for d5eyka_:

Click to download the PDB-style file with coordinates for d5eyka_.
(The format of our PDB-style files is described here.)

Timeline for d5eyka_: