| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) ![]() |
| Family d.58.7.0: automated matches [191529] (1 protein) not a true family |
| Protein automated matches [190896] (11 species) not a true protein |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [279753] (7 PDB entries) |
| Domain d5d77a1: 5d77 A:313-388 [321276] Other proteins in same PDB: d5d77a2 automated match to d2sxla_ complexed with cit, na, no3 |
PDB Entry: 5d77 (more details), 1.3 Å
SCOPe Domain Sequences for d5d77a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5d77a1 d.58.7.0 (A:313-388) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ktilvknlpsdttqeevldyfstigpiksvfisekqantphkafvtykneeeskkaqkcl
nktifknhtiwvgpgk
Timeline for d5d77a1: