Lineage for d5d77a1 (5d77 A:313-388)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2558725Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 2559336Family d.58.7.0: automated matches [191529] (1 protein)
    not a true family
  6. 2559337Protein automated matches [190896] (11 species)
    not a true protein
  7. 2559355Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [279753] (7 PDB entries)
  8. 2559357Domain d5d77a1: 5d77 A:313-388 [321276]
    Other proteins in same PDB: d5d77a2
    automated match to d2sxla_
    complexed with cit, na, no3

Details for d5d77a1

PDB Entry: 5d77 (more details), 1.3 Å

PDB Description: structure of mip6 rrm3 domain
PDB Compounds: (A:) RNA-binding protein MIP6

SCOPe Domain Sequences for d5d77a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5d77a1 d.58.7.0 (A:313-388) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ktilvknlpsdttqeevldyfstigpiksvfisekqantphkafvtykneeeskkaqkcl
nktifknhtiwvgpgk

SCOPe Domain Coordinates for d5d77a1:

Click to download the PDB-style file with coordinates for d5d77a1.
(The format of our PDB-style files is described here.)

Timeline for d5d77a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5d77a2