Lineage for d5eyab_ (5eya B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2546033Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2546034Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2546035Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 2546043Protein Ubiquitin conjugating enzyme, UBC [54497] (34 species)
  7. 2546139Species Human (Homo sapiens), ubc13 [TaxId:9606] [64240] (19 PDB entries)
  8. 2546153Domain d5eyab_: 5eya B: [321269]
    Other proteins in same PDB: d5eyac_, d5eyad_
    automated match to d3w31b_
    complexed with zn

Details for d5eyab_

PDB Entry: 5eya (more details), 2.4 Å

PDB Description: trim25 ring domain in complex with ubc13-ub conjugate
PDB Compounds: (B:) Ubiquitin-conjugating enzyme E2 N

SCOPe Domain Sequences for d5eyab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5eyab_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc13 [TaxId: 9606]}
glprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpeey
pmaapkvrfmtkiyhpnvdklgrikldilkdkwspalqirtvllsiqallsapnpddpla
ndvaeqwktneaqaietarawtrlyamnn

SCOPe Domain Coordinates for d5eyab_:

Click to download the PDB-style file with coordinates for d5eyab_.
(The format of our PDB-style files is described here.)

Timeline for d5eyab_: