Lineage for d5fa6a3 (5fa6 A:522-680)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2467994Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 2467995Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) (S)
    binds NADP differently than classical Rossmann-fold
    N-terminal FAD-linked domain contains (6,10) barrel
  5. 2468165Family c.25.1.0: automated matches [227163] (1 protein)
    not a true family
  6. 2468166Protein automated matches [226871] (19 species)
    not a true protein
  7. 2468182Species Human (Homo sapiens) [TaxId:9606] [226188] (8 PDB entries)
  8. 2468193Domain d5fa6a3: 5fa6 A:522-680 [321268]
    Other proteins in same PDB: d5fa6a1, d5fa6a2, d5fa6b1, d5fa6b2
    automated match to d1j9za3
    complexed with fad, fmn, nap

Details for d5fa6a3

PDB Entry: 5fa6 (more details), 2.3 Å

PDB Description: wild type human cypor
PDB Compounds: (A:) NADPH--cytochrome P450 reductase

SCOPe Domain Sequences for d5fa6a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fa6a3 c.25.1.0 (A:522-680) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rlpfkattpvimvgpgtgvapfigfiqerawlrqqgkevgetllyygcrrsdedylyree
laqfhrdgaltqlnvafsreqshkvyvqhllkqdrehlwklieggahiyvcgdarnmard
vqntfydivaelgamehaqavdyikklmtkgrysldvws

SCOPe Domain Coordinates for d5fa6a3:

Click to download the PDB-style file with coordinates for d5fa6a3.
(The format of our PDB-style files is described here.)

Timeline for d5fa6a3: