| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.5: Flavoproteins [52218] (9 families) ![]() |
| Family c.23.5.0: automated matches [191330] (1 protein) not a true family |
| Protein automated matches [190158] (24 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [226640] (6 PDB entries) |
| Domain d5emna1: 5emn A:70-240 [321263] Other proteins in same PDB: d5emna2, d5emna3, d5emnb2, d5emnb3 automated match to d1ja1a2 complexed with fad, fmn, nap; mutant |
PDB Entry: 5emn (more details), 2.2 Å
SCOPe Domain Sequences for d5emna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5emna1 c.23.5.0 (A:70-240) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ssfvekmkktgrniivfygsqtgtaeefanrlskdahrygmrgmsadpeeydladlsslp
eidnalvvfcmatygegdptdnaqdfydwlqetdvdlsgvkfavfglgnktyehfnamgk
yvdkrleqlgaqrifelglgdddgnleedfitwreqfwlavcehfgveatg
Timeline for d5emna1: