Lineage for d5emna1 (5emn A:70-240)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114715Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2115525Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2116045Family c.23.5.0: automated matches [191330] (1 protein)
    not a true family
  6. 2116046Protein automated matches [190158] (24 species)
    not a true protein
  7. 2116105Species Human (Homo sapiens) [TaxId:9606] [226640] (6 PDB entries)
  8. 2116114Domain d5emna1: 5emn A:70-240 [321263]
    Other proteins in same PDB: d5emna2, d5emna3, d5emnb2, d5emnb3
    automated match to d1ja1a2
    complexed with fad, fmn, nap; mutant

Details for d5emna1

PDB Entry: 5emn (more details), 2.2 Å

PDB Description: crystal structure of human nadph-cytochrome p450 reductase(a287p mutant)
PDB Compounds: (A:) NADPH--cytochrome P450 reductase

SCOPe Domain Sequences for d5emna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5emna1 c.23.5.0 (A:70-240) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ssfvekmkktgrniivfygsqtgtaeefanrlskdahrygmrgmsadpeeydladlsslp
eidnalvvfcmatygegdptdnaqdfydwlqetdvdlsgvkfavfglgnktyehfnamgk
yvdkrleqlgaqrifelglgdddgnleedfitwreqfwlavcehfgveatg

SCOPe Domain Coordinates for d5emna1:

Click to download the PDB-style file with coordinates for d5emna1.
(The format of our PDB-style files is described here.)

Timeline for d5emna1: