| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
Superfamily d.20.1: UBC-like [54495] (5 families) ![]() |
| Family d.20.1.1: UBC-related [54496] (7 proteins) |
| Protein Ubiquitin conjugating enzyme, UBC [54497] (34 species) |
| Species Human (Homo sapiens), ubc13 [TaxId:9606] [64240] (19 PDB entries) |
| Domain d5eyaa_: 5eya A: [321262] Other proteins in same PDB: d5eyac_, d5eyad_ automated match to d3w31b_ complexed with zn |
PDB Entry: 5eya (more details), 2.4 Å
SCOPe Domain Sequences for d5eyaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5eyaa_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc13 [TaxId: 9606]}
glprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpeey
pmaapkvrfmtkiyhpnvdklgrikldilkdkwspalqirtvllsiqallsapnpddpla
ndvaeqwktneaqaietarawtrlyamnn
Timeline for d5eyaa_: