Lineage for d5emnb3 (5emn B:522-680)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2118600Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 2118601Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) (S)
    binds NADP differently than classical Rossmann-fold
    N-terminal FAD-linked domain contains (6,10) barrel
  5. 2118771Family c.25.1.0: automated matches [227163] (1 protein)
    not a true family
  6. 2118772Protein automated matches [226871] (18 species)
    not a true protein
  7. 2118789Species Human (Homo sapiens) [TaxId:9606] [226188] (7 PDB entries)
  8. 2118799Domain d5emnb3: 5emn B:522-680 [321253]
    Other proteins in same PDB: d5emna1, d5emna2, d5emnb1, d5emnb2
    automated match to d1j9za3
    complexed with fad, fmn, nap; mutant

Details for d5emnb3

PDB Entry: 5emn (more details), 2.2 Å

PDB Description: crystal structure of human nadph-cytochrome p450 reductase(a287p mutant)
PDB Compounds: (B:) NADPH--cytochrome P450 reductase

SCOPe Domain Sequences for d5emnb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5emnb3 c.25.1.0 (B:522-680) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rlpfkattpvimvgpgtgvapfigfiqerawlrqqgkevgetllyygcrrsdedylyree
laqfhrdgaltqlnvafsreqshkvyvqhllkqdrehlwklieggahiyvcgdarnmard
vqntfydivaelgamehaqavdyikklmtkgrysldvws

SCOPe Domain Coordinates for d5emnb3:

Click to download the PDB-style file with coordinates for d5emnb3.
(The format of our PDB-style files is described here.)

Timeline for d5emnb3: