Lineage for d5an7a1 (5an7 A:1002-1245)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2413784Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2414299Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (4 protein domains)
  6. 2414436Protein automated matches [190053] (9 species)
    not a true protein
  7. 2414466Species Sulfolobus solfataricus [TaxId:2287] [190005] (9 PDB entries)
  8. 2414469Domain d5an7a1: 5an7 A:1002-1245 [321241]
    Other proteins in same PDB: d5an7a2
    automated match to d4ijba_
    complexed with llk, po4

Details for d5an7a1

PDB Entry: 5an7 (more details), 1.1 Å

PDB Description: structure of the engineered retro-aldolase ra95.5-8f with a bound 1,3- diketone inhibitor
PDB Compounds: (A:) ra95.5-8f

SCOPe Domain Sequences for d5an7a1:

Sequence, based on SEQRES records: (download)

>d5an7a1 c.1.2.4 (A:1002-1245) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
prylkgwledvvqlslrrpsvhasrqrpiislnerilefnkrnitaiiayylrkspsgld
verdpieyakymepyavglsikteekyfdgsyemlrkiassvsipilmndfivkesqidd
aynlgadtvlliveiltereleslleyargygmeplilindendldialrigarfitiys
mnfetgeinkenqrklismipsnvvkvplldffepneieelrklgvnafmissslmrnpe
kike

Sequence, based on observed residues (ATOM records): (download)

>d5an7a1 c.1.2.4 (A:1002-1245) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
prylkgwledvvqlslrrpsvhasrqrpiislnerilefnkrnitaiiayylrkspverd
pieyakymepyavglsikteekyfdgsyemlrkiassvsipilmndfivkesqiddaynl
gadtvlliveiltereleslleyargygmeplilindendldialrigarfitiysmnfe
tgeinkenqrklismipsnvvkvplldffepneieelrklgvnafmissslmrnpekike

SCOPe Domain Coordinates for d5an7a1:

Click to download the PDB-style file with coordinates for d5an7a1.
(The format of our PDB-style files is described here.)

Timeline for d5an7a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5an7a2