Lineage for d1b23p3 (1b23 P:1-212)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1162955Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1162956Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1163638Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1163949Protein Elongation factor Tu (EF-Tu), N-terminal (G) domain [52626] (4 species)
  7. 1163971Species Thermus aquaticus [TaxId:271] [52628] (5 PDB entries)
  8. 1163972Domain d1b23p3: 1b23 P:1-212 [32124]
    Other proteins in same PDB: d1b23p1, d1b23p2
    protein/RNA complex; complexed with cys, gnp, mg, so4

Details for d1b23p3

PDB Entry: 1b23 (more details), 2.6 Å

PDB Description: e. coli cysteinyl-trna and t. aquaticus elongation factor ef-tu:gtp ternary complex
PDB Compounds: (P:) elongation factor tu

SCOPe Domain Sequences for d1b23p3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b23p3 c.37.1.8 (P:1-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus aquaticus [TaxId: 271]}
akgefirtkphvnvgtighvdhgkttltaaltyvaaaenpnvevkdygdidkapeerarg
itintahveyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehi
llarqvgvpyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallale
emhknpktkrgenewvdkiwelldaideyipt

SCOPe Domain Coordinates for d1b23p3:

Click to download the PDB-style file with coordinates for d1b23p3.
(The format of our PDB-style files is described here.)

Timeline for d1b23p3: