SCOP 1.75: Domain d1b23p3: 1b23 P:1-212

Lineage for d1b23p3 (1b23 P:1-212)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (78 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Elongation factor Tu (EF-Tu), N-terminal (G) domain [52626] (4 species)

7. Species Thermus aquaticus [TaxId:271] [52628] (4 PDB entries)

8. Domain d1b23p3: 1b23 P:1-212 [32124]
   Other proteins in same PDB: d1b23p1, d1b23p2
   complexed with aac, gnp, h2u, mg, mia, psu, s4u, so4

Details for d1b23p3

PDB Entry: 1b23, 2.6 Å

PDB Description: e. coli cysteinyl-trna and t. aquaticus elongation factor ef-tu:gtp ternary complex

PDB Compounds: (P:) elongation factor tu

SCOP Domain Sequences for d1b23p3:

Sequence; same for both SEQRES and ATOM records:

>d1b23p3 c.37.1.8 (P:1-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus aquaticus [TaxId: 271]}
akgefirtkphvnvgtighvdhgkttltaaltyvaaaenpnvevkdygdidkapeerarg
itintahveyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehi
llarqvgvpyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallale
emhknpktkrgenewvdkiwelldaideyipt

Timeline for d1b23p3:

• d1b23p3 first appeared (with stable ids) in SCOP 1.55
  
• d1b23p3 appears in SCOP 1.73
  
• d1b23p3 appears in SCOPe 2.01
  
• d1b23p3 appears in the current release, SCOPe 2.08