Lineage for d5d0eb1 (5d0e B:106-271)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2954779Superfamily d.58.29: Nucleotide cyclase [55073] (3 families) (S)
    common fold is elaborated with additional secondary structures
  5. 2954860Family d.58.29.0: automated matches [191671] (1 protein)
    not a true family
  6. 2954861Protein automated matches [191274] (13 species)
    not a true protein
  7. 2954897Species Mycobacterium avium [TaxId:1391991] [320949] (4 PDB entries)
  8. 2954899Domain d5d0eb1: 5d0e B:106-271 [321226]
    Other proteins in same PDB: d5d0ea2, d5d0eb2
    automated match to d2w01c_
    complexed with ca, cl, gtp

Details for d5d0eb1

PDB Entry: 5d0e (more details), 1.48 Å

PDB Description: crystal structure of an adenylyl cyclase ma1120-cat in complex with gtp and calcium from mycobacterium avium
PDB Compounds: (B:) Cyclase

SCOPe Domain Sequences for d5d0eb1:

Sequence, based on SEQRES records: (download)

>d5d0eb1 d.58.29.0 (B:106-271) automated matches {Mycobacterium avium [TaxId: 1391991]}
rvvilftdieestalnerigdrawvklisshdklvsdlvrrqsghvvksqgdgfmvafar
peqavrcgielqralrrnanrkrheeirvrigihmgrsvrrgddlfgrnvamaarvaaqa
aggeilvsqpvrdalsrsdgirfddgrevelkgfsgtyrlfavlas

Sequence, based on observed residues (ATOM records): (download)

>d5d0eb1 d.58.29.0 (B:106-271) automated matches {Mycobacterium avium [TaxId: 1391991]}
rvvilftdieestalnerigdrawvklisshdklvsdlvrrqsghvvksqgdgfmvafar
peqavrcgielqralrrnaneirvrigihmgrsvrrgddlfgrnvamaarvaaqaaggei
lvsqpvrdalsrsdgirfddgrevelkgfsgtyrlfavlas

SCOPe Domain Coordinates for d5d0eb1:

Click to download the PDB-style file with coordinates for d5d0eb1.
(The format of our PDB-style files is described here.)

Timeline for d5d0eb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5d0eb2