![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
![]() | Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) ![]() |
![]() | Family c.66.1.1: COMT-like [53336] (4 proteins) |
![]() | Protein automated matches [190251] (5 species) not a true protein |
![]() | Species Sorghum bicolor [TaxId:4558] [321178] (1 PDB entry) |
![]() | Domain d5kvab_: 5kva B: [321217] automated match to d1susa_ complexed with ca, sam |
PDB Entry: 5kva (more details), 1.83 Å
SCOPe Domain Sequences for d5kvab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5kvab_ c.66.1.1 (B:) automated matches {Sorghum bicolor [TaxId: 4558]} hksllksddlyqyildtsvyprepesmkelreitakhpwnlmttsadegqflnmliklig akktmeigvytgysllatalalpedgtilamdinrenyelglpciekagvahkidfregp alpvlddliadeknhgsfdfvfvdadkdnylnyhdrllklvklggligydntlwngsvvl pddapmrkyirfyrdfvlvlnkalaaderveicqlpvgdgvtlcrrvk
Timeline for d5kvab_: