Lineage for d5kzma_ (5kzm A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2413784Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2414299Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (4 protein domains)
  6. 2414436Protein automated matches [190053] (9 species)
    not a true protein
  7. 2414451Species Francisella tularensis [TaxId:177416] [321213] (1 PDB entry)
  8. 2414452Domain d5kzma_: 5kzm A: [321214]
    Other proteins in same PDB: d5kzmb_
    automated match to d3vnda_
    complexed with act, ca

Details for d5kzma_

PDB Entry: 5kzm (more details), 2.8 Å

PDB Description: crystal structure of tryptophan synthase alpha-beta chain complex from francisella tularensis
PDB Compounds: (A:) tryptophan synthase alpha chain

SCOPe Domain Sequences for d5kzma_:

Sequence, based on SEQRES records: (download)

>d5kzma_ c.1.2.4 (A:) automated matches {Francisella tularensis [TaxId: 177416]}
mtnryttlfanlekrnegafipfvtigdpnkalsfeiidtlvssgadalelgipfsdpla
dgptiqeaniralesgitpkdcfdiltkirakyphipiglllyanlvyangienfyqkcl
dagvdsiliadvpaheskefrdiakkvgiaqifiappdasestlkqiselgsgytyllsr
vgvtgtetaanmpvedvltklreynapkpvlgfgiskpeqvqqaikagaagaisgsatvk
iiqnnisnkqkmlneltyfvkemkaatln

Sequence, based on observed residues (ATOM records): (download)

>d5kzma_ c.1.2.4 (A:) automated matches {Francisella tularensis [TaxId: 177416]}
mtnryttlfanlekrnegafipfvtigdpnkalsfeiidtlvssgadalelgipfsdpla
dgptiqeaniralesgitpkdcfdiltkirakyphipiglllyanlvyangienfyqkcl
dagvdsiliadvpaheskefrdiakkvgiaqifiappdasestlkqiselgsgytyllsr
vgmpvedvltklreynapkpvlgfgiskpeqvqqaikagaagaisgsatvkiiqnnisnk
qkmlneltyfvkemkaatln

SCOPe Domain Coordinates for d5kzma_:

Click to download the PDB-style file with coordinates for d5kzma_.
(The format of our PDB-style files is described here.)

Timeline for d5kzma_: