Lineage for d5ldua1 (5ldu A:1-130)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2772201Family b.6.1.0: automated matches [191502] (1 protein)
    not a true family
  6. 2772202Protein automated matches [190824] (31 species)
    not a true protein
  7. 2772763Species Trametes hirsuta [TaxId:5327] [255835] (4 PDB entries)
  8. 2772773Domain d5ldua1: 5ldu A:1-130 [321210]
    automated match to d3pxla1
    complexed with cu, gol, na, nag

Details for d5ldua1

PDB Entry: 5ldu (more details), 2.3 Å

PDB Description: recombinant high-redox potential laccase from basidiomycete trametes hirsuta
PDB Compounds: (A:) Laccase A

SCOPe Domain Sequences for d5ldua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ldua1 b.6.1.0 (A:1-130) automated matches {Trametes hirsuta [TaxId: 5327]}
avgpvadltitdaavspdgfsrqavvvngvtpgplvagnigdrfqlnvidnltnhtmlks
tsihwhgffqhgtnwadgpafinqcpispghsflydfqvpdqagtfwyhshlstqycdgl
rgpfvvydpn

SCOPe Domain Coordinates for d5ldua1:

Click to download the PDB-style file with coordinates for d5ldua1.
(The format of our PDB-style files is described here.)

Timeline for d5ldua1: