SCOPe 2.08: Domain d5k81e_: 5k81 E:

Lineage for d5k81e_ (5k81 E:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
   core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest

4. Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families)
   contains extra C-terminal strand 5, order 21345

5. Family c.97.1.6: apolipoprotein B messenger RNA-editing enzyme catalytic (APOBEC) cytidine deaminase domains [310632] (5 proteins)
   strand 5 is parallel to strand 4
   Pfam PF08210; Pfam PF05240

6. Protein APOBEC3G (ARCD) [310757] (2 species)

7. Species Rhesus monkey (Macaca mulatta) [TaxId:9544] [346337] (6 PDB entries)

8. Domain d5k81e_: 5k81 E: [321209]
   automated match to d3vm8a_
   complexed with zn

Details for d5k81e_

PDB Entry: 5k81, 2.01 Å

PDB Description: crystal structure of a primate apobec3g n-terminal domain

PDB Compounds: (E:) Apolipoprotein B mRNA editing enzyme, catalytic peptide-like 3G,Apolipoprotein B mRNA editing enzyme, catalytic peptide-like 3G

SCOPe Domain Sequences for d5k81e_:

Sequence; same for both SEQRES and ATOM records:

>d5k81e_ c.97.1.6 (E:) APOBEC3G (ARCD) {Rhesus monkey (Macaca mulatta) [TaxId: 9544]}
rnmvepmdprtfvsnfnnrpilsgldtvwlccevktkdpsgppldakifqgkvypkakyh
pemrflrwfhkwrqlhhdqeykvtwyvswspctrcansvatflakdpkvtltifvarlyy
fwkpdyqqalrilaeagatmkimnynefqdcwnkfvdgrgkpfkpwnnlpkhytllqatl
gellrh

Timeline for d5k81e_:

• d5k81e_ first appeared in SCOPe 2.06
  
• d5k81e_ appears in SCOPe 2.07