Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies) core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest |
Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families) contains extra C-terminal strand 5, order 21345 |
Family c.97.1.6: apolipoprotein B messenger RNA-editing enzyme catalytic (APOBEC) cytidine deaminase domains [310632] (5 proteins) strand 5 is parallel to strand 4 Pfam PF08210; Pfam PF05240 |
Protein APOBEC3G (ARCD) [310757] (2 species) |
Species Rhesus monkey (Macaca mulatta) [TaxId:9544] [346337] (6 PDB entries) |
Domain d5k81e_: 5k81 E: [321209] automated match to d3vm8a_ complexed with zn |
PDB Entry: 5k81 (more details), 2.01 Å
SCOPe Domain Sequences for d5k81e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5k81e_ c.97.1.6 (E:) APOBEC3G (ARCD) {Rhesus monkey (Macaca mulatta) [TaxId: 9544]} rnmvepmdprtfvsnfnnrpilsgldtvwlccevktkdpsgppldakifqgkvypkakyh pemrflrwfhkwrqlhhdqeykvtwyvswspctrcansvatflakdpkvtltifvarlyy fwkpdyqqalrilaeagatmkimnynefqdcwnkfvdgrgkpfkpwnnlpkhytllqatl gellrh
Timeline for d5k81e_: