Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein Elongation factor Tu (EF-Tu), N-terminal (G) domain [52626] (4 species) |
Species Escherichia coli [TaxId:562] [52627] (9 PDB entries) Uniprot P02990 |
Domain d1d8tb3: 1d8t B:9-204 [32120] Other proteins in same PDB: d1d8ta1, d1d8ta2, d1d8tb1, d1d8tb2 complexed with act, gdp, mg |
PDB Entry: 1d8t (more details), 2.35 Å
SCOPe Domain Sequences for d1d8tb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d8tb3 c.37.1.8 (B:9-204) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Escherichia coli [TaxId: 562]} kphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekargitintshve ydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrqvgvp yiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkalegdaeweaki lelagfldsyipeper
Timeline for d1d8tb3: