Lineage for d1d8tb3 (1d8t B:9-204)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 987024Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 987025Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 987698Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 987996Protein Elongation factor Tu (EF-Tu), N-terminal (G) domain [52626] (4 species)
  7. 988003Species Escherichia coli [TaxId:562] [52627] (9 PDB entries)
    Uniprot P02990
  8. 988011Domain d1d8tb3: 1d8t B:9-204 [32120]
    Other proteins in same PDB: d1d8ta1, d1d8ta2, d1d8tb1, d1d8tb2
    complexed with act, gdp, mg

Details for d1d8tb3

PDB Entry: 1d8t (more details), 2.35 Å

PDB Description: crystal structure of elongation factor, tu (ef-tu-mggdp) complexed with ge2270a, a thiazolyl peptide antibiotic
PDB Compounds: (B:) elongation factor tu

SCOPe Domain Sequences for d1d8tb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d8tb3 c.37.1.8 (B:9-204) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Escherichia coli [TaxId: 562]}
kphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekargitintshve
ydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrqvgvp
yiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkalegdaeweaki
lelagfldsyipeper

SCOPe Domain Coordinates for d1d8tb3:

Click to download the PDB-style file with coordinates for d1d8tb3.
(The format of our PDB-style files is described here.)

Timeline for d1d8tb3: