Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (29 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries) |
Domain d5kvel_: 5kve L: [321192] Other proteins in same PDB: d5kvee_, d5kveh1, d5kveh2 automated match to d4lrnl_ complexed with act, edo, na, so4 |
PDB Entry: 5kve (more details), 1.7 Å
SCOPe Domain Sequences for d5kvel_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5kvel_ b.1.1.0 (L:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} mdivmsqspsslavsvgekitmsckssqsllysnneknylawyqqkpgqspklliywasa rdsgvpdrftgsgsgtdftltissvkaedlavfycqqyysypytfgggtkleikg
Timeline for d5kvel_: