| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
| Species Escherichia coli [TaxId:562] [52627] (10 PDB entries) Uniprot P02990 |
| Domain d1d8ta3: 1d8t A:3-204 [32119] Other proteins in same PDB: d1d8ta1, d1d8ta2, d1d8tb1, d1d8tb2 complexed with act, gdp, mg |
PDB Entry: 1d8t (more details), 2.35 Å
SCOPe Domain Sequences for d1d8ta3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d8ta3 c.37.1.8 (A:3-204) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Escherichia coli [TaxId: 562]}
ekfertkphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekargiti
ntshveydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehillg
rqvgvpyiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkalegda
eweakilelagfldsyipeper
Timeline for d1d8ta3: