Lineage for d5k59f1 (5k59 F:1-106)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2759025Domain d5k59f1: 5k59 F:1-106 [321184]
    Other proteins in same PDB: d5k59a_, d5k59b_, d5k59c_, d5k59d_, d5k59f2, d5k59l2
    automated match to d1dn0a1
    complexed with cl, pg4, po4

Details for d5k59f1

PDB Entry: 5k59 (more details), 2.84 Å

PDB Description: crystal structure of lukgh from staphylococcus aureus in complex with a neutralising antibody
PDB Compounds: (F:) Fab light chain

SCOPe Domain Sequences for d5k59f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5k59f1 b.1.1.0 (F:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspsslsasvgdrvtitcrasqsinsylnwyqqkpgkapklliyaasslqsgvps
rfsgsgsgtdftltisslqpedfatyycqqqfdppftfgggtkvei

SCOPe Domain Coordinates for d5k59f1:

Click to download the PDB-style file with coordinates for d5k59f1.
(The format of our PDB-style files is described here.)

Timeline for d5k59f1: