Lineage for d5jowb2 (5jow B:323-522)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2373039Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2373040Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2375103Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2375104Protein automated matches [190437] (63 species)
    not a true protein
  7. 2375186Species Bacteroides ovatus [TaxId:411476] [321042] (1 PDB entry)
  8. 2375188Domain d5jowb2: 5jow B:323-522 [321182]
    Other proteins in same PDB: d5jowa1, d5jowa3, d5jowb1, d5jowb3
    automated match to d1yrza1
    complexed with edo, trs

Details for d5jowb2

PDB Entry: 5jow (more details), 1.6 Å

PDB Description: bacteroides ovatus xyloglucan pul gh43a
PDB Compounds: (B:) Non-reducing end alpha-L-arabinofuranosidase BoGH43A

SCOPe Domain Sequences for d5jowb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jowb2 b.29.1.0 (B:323-522) automated matches {Bacteroides ovatus [TaxId: 411476]}
rperidfkegklspewihlqnpeaknyiftkdgklrliatpvtlsdwksptfvalrqehf
dmeasapvvlqkagvndeagisvfmefhshydlfvrqdkdrkrsvglryklgeithyake
vslptdgevelvvksdinyyyfgykvngiyhdlgkmntrylstetaggftgvvlglyits
askdskayadfeyfkykgkp

SCOPe Domain Coordinates for d5jowb2:

Click to download the PDB-style file with coordinates for d5jowb2.
(The format of our PDB-style files is described here.)

Timeline for d5jowb2: