Lineage for d5jowb1 (5jow B:21-322)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2074534Fold b.67: 5-bladed beta-propeller [50933] (3 superfamilies)
    consists of five 4-stranded beta-sheet motifs; meander
  4. 2074544Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (6 families) (S)
  5. 2074711Family b.67.2.0: automated matches [227228] (1 protein)
    not a true family
  6. 2074712Protein automated matches [226971] (3 species)
    not a true protein
  7. 2074720Species Bacteroides ovatus [TaxId:411476] [321040] (1 PDB entry)
  8. 2074722Domain d5jowb1: 5jow B:21-322 [321181]
    Other proteins in same PDB: d5jowa2, d5jowa3, d5jowb2, d5jowb3
    automated match to d1yrza2
    complexed with edo, trs

Details for d5jowb1

PDB Entry: 5jow (more details), 1.6 Å

PDB Description: bacteroides ovatus xyloglucan pul gh43a
PDB Compounds: (B:) Non-reducing end alpha-L-arabinofuranosidase BoGH43A

SCOPe Domain Sequences for d5jowb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jowb1 b.67.2.0 (B:21-322) automated matches {Bacteroides ovatus [TaxId: 411476]}
qgysnpvipgfhpdpsvckagddyylvnssfqyfpgvplfhskdlvhweqigncltrpsq
ldltnansgsgifaptiryndgvfymittnvsgkgnflvhttdprsewsepvwleqggid
pslyfedgkcfmvsnpdgyinlceidpmtgkqlssskriwngtggryaegphiykkdgwy
ylliseggtelghkvtiarsryidgpyqgnpanpilthanesgqsspiqgtghadlvegt
dgswwmvclayrimpgthhtlgretylapvrwdkdawpvvnsngtislkmdvptlpqqem
kg

SCOPe Domain Coordinates for d5jowb1:

Click to download the PDB-style file with coordinates for d5jowb1.
(The format of our PDB-style files is described here.)

Timeline for d5jowb1: