SCOP 1.75: Domain d1dg1h3: 1dg1 H:9-204

Lineage for d1dg1h3 (1dg1 H:9-204)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (78 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Elongation factor Tu (EF-Tu), N-terminal (G) domain [52626] (4 species)

7. Species Escherichia coli [TaxId:562] [52627] (9 PDB entries)
   Uniprot P02990

8. Domain d1dg1h3: 1dg1 H:9-204 [32118]
   Other proteins in same PDB: d1dg1g1, d1dg1g2, d1dg1h1, d1dg1h2

Details for d1dg1h3

PDB Entry: 1dg1, 2.5 Å

PDB Description: whole, unmodified, ef-tu(elongation factor tu).

PDB Compounds: (H:) elongation factor tu

SCOP Domain Sequences for d1dg1h3:

Sequence; same for both SEQRES and ATOM records:

>d1dg1h3 c.37.1.8 (H:9-204) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Escherichia coli [TaxId: 562]}
kphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekargitintshve
ydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrqvgvp
yiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkalegdaeweaki
lelagfldsyipeper

Timeline for d1dg1h3:

• d1dg1h3 first appeared (with stable ids) in SCOP 1.55
  
• d1dg1h3 appears in SCOP 1.73
  
• d1dg1h3 appears in SCOPe 2.01
  
• d1dg1h3 appears in the current release, SCOPe 2.08