Lineage for d1dg1h3 (1dg1 H:9-204)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 69448Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 69449Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (15 families) (S)
  5. 69650Family c.37.1.8: G proteins [52592] (20 proteins)
  6. 69737Protein Elongation factor Tu (EF-Tu), N-terminal (G) domain [52626] (4 species)
  7. 69743Species Escherichia coli [TaxId:562] [52627] (6 PDB entries)
  8. 69749Domain d1dg1h3: 1dg1 H:9-204 [32118]
    Other proteins in same PDB: d1dg1g1, d1dg1g2, d1dg1h1, d1dg1h2

Details for d1dg1h3

PDB Entry: 1dg1 (more details), 2.5 Å

PDB Description: whole, unmodified, ef-tu(elongation factor tu).

SCOP Domain Sequences for d1dg1h3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dg1h3 c.37.1.8 (H:9-204) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Escherichia coli}
kphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekargitintshve
ydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrqvgvp
yiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkalegdaeweaki
lelagfldsyipeper

SCOP Domain Coordinates for d1dg1h3:

Click to download the PDB-style file with coordinates for d1dg1h3.
(The format of our PDB-style files is described here.)

Timeline for d1dg1h3: