Lineage for d5kvaa_ (5kva A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2145089Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2145090Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2145091Family c.66.1.1: COMT-like [53336] (4 proteins)
  6. 2145260Protein automated matches [190251] (5 species)
    not a true protein
  7. 2145282Species Sorghum bicolor [TaxId:4558] [321178] (1 PDB entry)
  8. 2145283Domain d5kvaa_: 5kva A: [321179]
    automated match to d1susa_
    complexed with ca, sam

Details for d5kvaa_

PDB Entry: 5kva (more details), 1.83 Å

PDB Description: crystal structure of sorghum caffeoyl-coa o-methyltransferase (ccoaomt)
PDB Compounds: (A:) Caffeoyl-CoA O-methyltransferase

SCOPe Domain Sequences for d5kvaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kvaa_ c.66.1.1 (A:) automated matches {Sorghum bicolor [TaxId: 4558]}
ksllksddlyqyildtsvyprepesmkelreitakhpwnlmttsadegqflnmlikliga
kktmeigvytgysllatalalpedgtilamdinrenyelglpciekagvahkidfregpa
lpvlddliadeknhgsfdfvfvdadkdnylnyhdrllklvklggligydntlwngsvvlp
ddapmrkyirfyrdfvlvlnkalaaderveicqlpvgdgvtlcrrvk

SCOPe Domain Coordinates for d5kvaa_:

Click to download the PDB-style file with coordinates for d5kvaa_.
(The format of our PDB-style files is described here.)

Timeline for d5kvaa_: