Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 has additional subdomain(s) that are not in the common domain |
Protein Enoyl-ACP reductase [51791] (11 species) |
Species Mycobacterium tuberculosis, TB, gene InhA [TaxId:1773] [51793] (96 PDB entries) |
Domain d5jfoa_: 5jfo A: [321172] automated match to d1p44a_ complexed with 6ka, nad |
PDB Entry: 5jfo (more details), 2.91 Å
SCOPe Domain Sequences for d5jfoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5jfoa_ c.2.1.2 (A:) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} tglldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrlrliqritdrlpakapll eldvqneehlaslagrvteaigagnkldgvvhsigfmpqtgmginpffdapyadvskgih isaysyasmakallpimnpggsivgmdfdpsrampaynwmtvaksalesvnrfvareagk ygvrsnlvaagpirtlamsaivggalgeeagaqiqlleegwdqrapigwnmkdatpvakt vcallsdwlpattgdiiyadggahtqll
Timeline for d5jfoa_: