Lineage for d5l3na_ (5l3n A:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2634416Fold g.1: Insulin-like [56993] (1 superfamily)
    nearly all-alpha
    can be classified as disulfide-rich
  4. 2634417Superfamily g.1.1: Insulin-like [56994] (1 family) (S)
  5. 2634418Family g.1.1.1: Insulin-like [56995] (5 proteins)
  6. 2634641Protein Insulin-like growth factor [57002] (1 species)
  7. 2634642Species Human (Homo sapiens) [TaxId:9606] [57003] (23 PDB entries)
    Uniprot P05019 49-110
  8. 2634656Domain d5l3na_: 5l3n A: [321171]
    automated match to d1igla_

Details for d5l3na_

PDB Entry: 5l3n (more details)

PDB Description: d11 bound [n29, s39_pq]-igf-ii
PDB Compounds: (A:) insulin-like growth factor II

SCOPe Domain Sequences for d5l3na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l3na_ g.1.1.1 (A:) Insulin-like growth factor {Human (Homo sapiens) [TaxId: 9606]}
ayrpsetlcggelvdtlqfvcgdrgfyfnrpasrvsrrspqrgiveeccfrscdlallet
ycatpakse

SCOPe Domain Coordinates for d5l3na_:

Click to download the PDB-style file with coordinates for d5l3na_.
(The format of our PDB-style files is described here.)

Timeline for d5l3na_: