![]() | Class g: Small proteins [56992] (98 folds) |
![]() | Fold g.1: Insulin-like [56993] (1 superfamily) nearly all-alpha can be classified as disulfide-rich |
![]() | Superfamily g.1.1: Insulin-like [56994] (1 family) ![]() |
![]() | Family g.1.1.1: Insulin-like [56995] (5 proteins) |
![]() | Protein Insulin-like growth factor [57002] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [57003] (23 PDB entries) Uniprot P05019 49-110 |
![]() | Domain d5l3na_: 5l3n A: [321171] automated match to d1igla_ |
PDB Entry: 5l3n (more details)
SCOPe Domain Sequences for d5l3na_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5l3na_ g.1.1.1 (A:) Insulin-like growth factor {Human (Homo sapiens) [TaxId: 9606]} ayrpsetlcggelvdtlqfvcgdrgfyfnrpasrvsrrspqrgiveeccfrscdlallet ycatpakse
Timeline for d5l3na_: