Class g: Small proteins [56992] (100 folds) |
Fold g.1: Insulin-like [56993] (1 superfamily) nearly all-alpha can be classified as disulfide-rich |
Superfamily g.1.1: Insulin-like [56994] (1 family) |
Family g.1.1.1: Insulin-like [56995] (5 proteins) |
Protein Insulin-like growth factor [57002] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [57003] (23 PDB entries) Uniprot P05019 49-110 |
Domain d5l3la_: 5l3l A: [321165] automated match to d1igla_ |
PDB Entry: 5l3l (more details)
SCOPe Domain Sequences for d5l3la_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5l3la_ g.1.1.1 (A:) Insulin-like growth factor {Human (Homo sapiens) [TaxId: 9606]} ayrpsetlcggelvdtlqfvcgdrgfyfsrpasrvsrrsrgiveeccfrscdlalletyc atpakse
Timeline for d5l3la_: