Lineage for d1efuc3 (1efu C:9-204)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 393331Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 393332Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) (S)
    division into families based on beta-sheet topologies
  5. 393753Family c.37.1.8: G proteins [52592] (37 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 393911Protein Elongation factor Tu (EF-Tu), N-terminal (G) domain [52626] (4 species)
  7. 393917Species Escherichia coli [TaxId:562] [52627] (6 PDB entries)
  8. 393925Domain d1efuc3: 1efu C:9-204 [32116]
    Other proteins in same PDB: d1efua1, d1efua2, d1efub2, d1efub3, d1efub4, d1efuc1, d1efuc2, d1efud2, d1efud3, d1efud4

Details for d1efuc3

PDB Entry: 1efu (more details), 2.5 Å

PDB Description: elongation factor complex ef-tu/ef-ts from escherichia coli

SCOP Domain Sequences for d1efuc3:

Sequence, based on SEQRES records: (download)

>d1efuc3 c.37.1.8 (C:9-204) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Escherichia coli}
kphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekargitintshve
ydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrqvgvp
yiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkalegdaeweaki
lelagfldsyipeper

Sequence, based on observed residues (ATOM records): (download)

>d1efuc3 c.37.1.8 (C:9-204) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Escherichia coli}
kphvnvgtighvdhgkttltaaittvlaktyggatshveydtptrhyahvdcpghadyvk
nmitgaaqmdgailvvaatdgpmpqtrehillgrqvgvpyiivflnkcdmvddeellelv
emevrellsqydfpgddtpivrgsalkalegdaeweakilelagfldsyipeper

SCOP Domain Coordinates for d1efuc3:

Click to download the PDB-style file with coordinates for d1efuc3.
(The format of our PDB-style files is described here.)

Timeline for d1efuc3: