Lineage for d1efuc3 (1efu C:9-204)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 69448Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 69449Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (15 families) (S)
  5. 69650Family c.37.1.8: G proteins [52592] (20 proteins)
  6. 69737Protein Elongation factor Tu (EF-Tu), N-terminal (G) domain [52626] (4 species)
  7. 69743Species Escherichia coli [TaxId:562] [52627] (6 PDB entries)
  8. 69751Domain d1efuc3: 1efu C:9-204 [32116]
    Other proteins in same PDB: d1efua1, d1efua2, d1efub2, d1efub3, d1efub4, d1efuc1, d1efuc2, d1efud2, d1efud3, d1efud4

Details for d1efuc3

PDB Entry: 1efu (more details), 2.5 Å

PDB Description: elongation factor complex ef-tu/ef-ts from escherichia coli

SCOP Domain Sequences for d1efuc3:

Sequence, based on SEQRES records: (download)

>d1efuc3 c.37.1.8 (C:9-204) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Escherichia coli}
kphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekargitintshve
ydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrqvgvp
yiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkalegdaeweaki
lelagfldsyipeper

Sequence, based on observed residues (ATOM records): (download)

>d1efuc3 c.37.1.8 (C:9-204) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Escherichia coli}
kphvnvgtighvdhgkttltaaittvlaktyggatshveydtptrhyahvdcpghadyvk
nmitgaaqmdgailvvaatdgpmpqtrehillgrqvgvpyiivflnkcdmvddeellelv
emevrellsqydfpgddtpivrgsalkalegdaeweakilelagfldsyipeper

SCOP Domain Coordinates for d1efuc3:

Click to download the PDB-style file with coordinates for d1efuc3.
(The format of our PDB-style files is described here.)

Timeline for d1efuc3: