SCOPe 2.06: Domain d5jzva1: 5jzv A:1-172

Lineage for d5jzva1 (5jzv A:1-172)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (130 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186862] (124 PDB entries)

8. Domain d5jzva1: 5jzv A:1-172 [321157]
   Other proteins in same PDB: d5jzva2
   automated match to d1y63a_
   complexed with adp

Details for d5jzva1

PDB Entry: 5jzv, 2.07 Å

PDB Description: the structure of d77g hcinap-adp

PDB Compounds: (A:) Adenylate kinase isoenzyme 6

SCOPe Domain Sequences for d5jzva1:

Sequence; same for both SEQRES and ATOM records:

>d5jzva1 c.37.1.0 (A:1-172) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mllpnilltgtpgvgkttlgkelasksglkyinvgdlareeqlydgydeeydcpildedr
vvdeldnqmreggvivgyhgcdffperwfhivfvlrtdtnvlyerletrgynekkltdni
qceifqvlyeeatasykeeivhqlpsnkpeelennvdqilkwieqwikdhns

Timeline for d5jzva1:

• d5jzva1 is new in SCOPe 2.06-stable
  
• d5jzva1 appears in SCOPe 2.07
  
• d5jzva1 appears in the current release, SCOPe 2.08